MG1655
W3110
Search for
  Japanese | English
Gene - Fasta Format
Fasta Format
    Download ftsQ_aa.seq
    Gene name ftsQ
    Length 276aa
    Fasta Format

>ftsQ
MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKL
VLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELK
IHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQM
LAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKR
ISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ