MG1655
W3110
Search for
Japanese | English
Gene - Fasta Format
Fasta Format
    Download lacA_aa.seq
    Gene name lacA
    Length 203aa
    Fasta Format

>lacA
MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGE
NAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHE
LRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCR
VIREINDRDKHYYFKDYKVESSV