MG1655
W3110
Search for
Japanese | English
Gene - Fasta Format
Fasta Format
    Download hisQ_aa.seq
    Gene name hisQ
    Length 228aa
    Fasta Format

>hisQ
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL