MG1655
W3110
Search for
Japanese | English
Gene - Fasta Format
Fasta Format
    Download narI_aa.seq
    Gene name narI
    Length 225aa
    Fasta Format

>narI
MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGIL
GIFVGHFFGMLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRA
TTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGV
AFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH